| Gene extracted from a human prediction (XML format) |
<?xml version="1.0" ?>
<!DOCTYPE prediction SYSTEM "geneid.dtd">
<prediction locus="AF100956_AF027865" length="140000" source="geneid_v1.2"
date="Thu Sep 27 12:52:58 2001" genes="10" score ="204.19">
...
<gene idGene="AF100956_AF027865.G5" strand ="fwd" exons="6" score="12.35">
<exon idExon="AF100956_AF027865.G5E1" type="First" frame="0" score="5.38">
<site idSite="AF100956_AF027865.G5E1S1" type="Start" position="65038" score="3.06" />
<site idSite="AF100956_AF027865.G5E1S2" type="Donor" position="65220" score="2.89" />
</exon>
<exon idExon="AF100956_AF027865.G5E2" type="Internal" frame="0" score="-0.93">
<site idSite="AF100956_AF027865.G5E2S1" type="Acceptor" position="65872" score="2.58" />
<site idSite="AF100956_AF027865.G5E2S2" type="Donor" position="66019" score="0.44" />
</exon>
<exon idExon="AF100956_AF027865.G5E3" type="Internal" frame="2" score="-0.44">
<site idSite="AF100956_AF027865.G5E3S1" type="Acceptor" position="66210" score="2.20" />
<site idSite="AF100956_AF027865.G5E3S2" type="Donor" position="66321" score="3.78" />
</exon>
<exon idExon="AF100956_AF027865.G5E4" type="Internal" frame="1" score="2.57">
<site idSite="AF100956_AF027865.G5E4S1" type="Acceptor" position="66774" score="2.22" />
<site idSite="AF100956_AF027865.G5E4S2" type="Donor" position="66903" score="3.50" />
</exon>
<exon idExon="AF100956_AF027865.G5E5" type="Internal" frame="0" score="4.80">
<site idSite="AF100956_AF027865.G5E5S1" type="Acceptor" position="67344" score="2.54" />
<site idSite="AF100956_AF027865.G5E5S2" type="Donor" position="67548" score="1.45" />
</exon>
<exon idExon="AF100956_AF027865.G5E6" type="Terminal" frame="2" score="0.97">
<site idSite="AF100956_AF027865.G5E6S1" type="Acceptor" position="67811" score="4.31" />
<site idSite="AF100956_AF027865.G5E6S2" type="Stop" position="67899" score="0.00" />
</exon>
<protein length="289">
MALLDLCGAARGQRPEWAALDAGSGGRSDPGHYSFSAQAPELALPRGMQVRTVGRSGEMQ
EPTAFLRSFGGDQERNVQIEMAHGTTTLAFKFQHGVIVAVDSRATAGSYISSLRMNKVIE
INPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQYRGMGLS
MGSMICGWDKKGPGLYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEEAYDLG
RRAIAYATHRDNYSGGVVNMYHMKEDGWVKVESSDVSDLLYKYGEAAL*
</protein>
</gene>
...
</prediction>
|
| Description of columns (gff format) | |
| XML headers | XML Version and DTD used |
| Prediction | Prediction as a collection of genes |
| Gene | Gene as a collection of exons |
| Exon | Gene as a couple of sites |
| Site | Splice site or transcription signal description |
| Key | Predicted protein |
Enrique Blanco Garcia © 2003